быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DDR2 Rabbit mAb (A4296)
- Описание
- Характеристики
-
Overview
Product name DDR2 Rabbit mAb Catalog No. A4296 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0958 Background
This gene encodes a member of the discoidin domain receptor subclass of the receptor tyrosine kinase (RTKs) protein family. RTKs play a key role in the communication of cells with their microenvironment. The encoded protein is a collagen-induced receptor that activates signal transduction pathways involved in cell adhesion, proliferation, and extracellular matrix remodeling. This protein is expressed in numerous cell types and may alos be involved in wound repair and regulate tumor growth and invasiveness. Mutations in this gene are the cause of short limb-hand type spondylometaepiphyseal dysplasia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 756-855 of human DDR2 (Q16832). Sequence WESILLGKFTTASDVWAFGVTLWETFTFCQEQPYSQLSDEQVIENTGEFFRDQGRQTYLPQPAICPDSVYKLMLSCWRRDTKNRPSFQEIHLLLLQQGDE Gene ID Swiss Prot Synonyms TKT; WRCN; MIG20a; NTRKR3; TYRO10 Calculated MW 97kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-2 OS, A-549, SH-SY5Y, Mouse lung, Mouse brain, Rat lung Cellular location Cell membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using DDR2 Rabbit mAb (A4296) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 756-855 of human DDR2 (Q16832). Isotype IgG