быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304)
- Описание
- Характеристики
-
Overview
Product name Placental alkaline phosphatase (PLAP) Rabbit mAb Catalog No. A4304 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0961 Background
The protein encoded by this gene is an alkaline phosphatase, a metalloenzyme that catalyzes the hydrolysis of phosphoric acid monoesters. It belongs to a multigene family composed of four alkaline phosphatase isoenzymes. The enzyme functions as a homodimer and has a catalytic site containing one magnesium and two zinc ions, which are required for its enzymatic function. One of the main sources of this enzyme is the liver, and thus, it's one of several indicators of liver injury in different clinical conditions. In pregnant women, this protein is primarily expressed in placental and endometrial tissue, however, strong ectopic expression has been detected in ovarian adenocarcinoma, serous cystadenocarcinoma, and other ovarian cancer cells.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Placental alkaline phosphatase (PLAP) (P05187). Sequence ALSKTYNVDKHVPDSGATATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASA Gene ID Swiss Prot Synonyms ALP; IAP; ALPI; PALP; PLAP; PLAP-1 Calculated MW 58kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples PC-3 cells, Mouse testis Cellular location Cell membrane, GPI-anchor, Lipid-anchor 
Western blot analysis of extracts of PC-3 cells, using Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of Mouse testis, using Placental alkaline phosphatase (PLAP) Rabbit mAb (A4304) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded Human placenta using Placental alkaline phosphatase (PLAP) antibody (A4304) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Placental alkaline phosphatase (PLAP) (P05187). KO Validated Validated Isotype IgG