быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Rad18 Rabbit mAb (A4339)
- Описание
- Характеристики
-
Overview
Product name Rad18 Rabbit mAb Catalog No. A4339 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1058 Background
The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad18 (Q9NS91). Sequence MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESP Gene ID Swiss Prot Synonyms RNF73 Calculated MW 56kDa Observed MW 70kDa/90kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A-549, MCF7, K-562, Mouse testis, Mouse brain, Mouse spleen, Rat testis Cellular location Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center 
Western blot analysis of extracts of various cell lines, using Rad18 Rabbit mAb (A4339) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad18 (Q9NS91). Isotype IgG