быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DYNLL1 Rabbit mAb (A4353)
- Описание
- Характеристики
-
Overview
Product name DYNLL1 Rabbit mAb Catalog No. A4353 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0975 Background
Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1, 200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (P63167). Sequence MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG Gene ID Swiss Prot Synonyms LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1 Calculated MW 10kDa Observed MW 10kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, U-87MG, Mouse testis, Mouse brain, Rat lung, Rat testis Cellular location Cytoplasm, Mitochondrion, Nucleus, cytoskeleton 
Western blot analysis of extracts of various cell lines, using DYNLL1 Rabbit mAb (A4353) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human colon using DYNLL1 Rabbit mAb (A4353) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-89 of human DYNLL1 (P63167). Isotype IgG







