быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PSA/KLK3 Rabbit mAb (A4355)
- Описание
- Характеристики
-
Overview
Product name PSA/KLK3 Rabbit mAb Catalog No. A4355 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0976 Background
Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease which is synthesized in the epithelial cells of the prostate gland, and is present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. The serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PSA/KLK3 (P07288). Sequence PEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP Gene ID Swiss Prot Synonyms APS; PSA; hK3; KLK2A1 Calculated MW 29kDa Observed MW 30kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples LNCaP Cellular location extracellular exosome, extracellular region, extracellular space, nucleus 
Western blot analysis of extracts of LNCaP cells, using PSA/KLK3 antibody (A4355) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PSA/KLK3 (P07288). Isotype IgG







