быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ERp57 Rabbit mAb (A4376)
- Описание
- Характеристики
-
Overview
Product name ERp57 Rabbit mAb Catalog No. A4376 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0987 Background
This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ERp57 (P30101). Sequence YPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNG Gene ID Swiss Prot Synonyms P58; ER60; ERp57; ERp60; ERp61; GRP57; GRP58; PI-PLC; HsT17083; HEL-S-269; HEL-S-93n Calculated MW 54kDa Observed MW 57kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, Hep G2 Cellular location Endoplasmic reticulum, Endoplasmic reticulum lumen, Melanosome 
Western blot analysis of extracts of various cell lines, using ERp57 Rabbit mAb (A4376) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human placenta using ERp57 Rabbit mAb (A4376) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ERp57 (P30101). Isotype IgG







