быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Stathmin 1 Rabbit mAb (A4379)
- Описание
- Характеристики
-
Overview
Product name Stathmin 1 Rabbit mAb Catalog No. A4379 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0989 Background
This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Stathmin 1 (P16949). Sequence KQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD Gene ID Swiss Prot Synonyms Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215 Calculated MW 17kDa Observed MW 18kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, Mouse testis, Mouse brain, Mouse thymus, Rat brain Cellular location Cytoplasm, cytoskeleton 
Western blot analysis of extracts of various cell lines, using Stathmin 1 Rabbit mAb (A4379) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry of paraffin-embedded human breast cancer using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human placenta using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human testis using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human tonsil using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse intestin using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse spleen using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat colon using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat spleen using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using Stathmin 1 Rabbit mAb (A4379) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Stathmin 1 (P16949). Isotype IgG