быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NEDD4 Rabbit mAb (A4385)
- Описание
- Характеристики
-
Overview
Product name NEDD4 Rabbit mAb Catalog No. A4385 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0992 Background
This gene is the founding member of the NEDD4 family of HECT ubiquitin ligases that function in the ubiquitin proteasome system of protein degradation. The encoded protein contains an N-terminal calcium and phospholipid binding C2 domain followed by multiple tryptophan-rich WW domains and, a C-terminal HECT ubiquitin ligase catalytic domain. It plays critical role in the regulation of a number of membrane receptors, endocytic machinery components and the tumor suppressor PTEN.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human NEDD4 (P46934). Sequence GDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEE Gene ID Swiss Prot Synonyms RPF1; NEDD4-1 Calculated MW 149kDa Observed MW 140kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, SH-SY5Y Cellular location Cell membrane, Cytoplasm, Peripheral membrane protein Customer validation WB(Homo sapiens)
Co-IP(Homo sapiens)
Western blot analysis of extracts of various cell lines, using NEDD4 Rabbit mAb (A4385) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human NEDD4 (P46934). Isotype IgG