быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BNIP1 Rabbit mAb (A4405)
- Описание
- Характеристики
-
Overview
Product name BNIP1 Rabbit mAb Catalog No. A4405 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2137 Background
This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. In addition, this protein is involved in vesicle transport into the endoplasmic reticulum. Alternative splicing of this gene results in four protein products with identical N- and C-termini.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human BNIP1 (Q12981). Sequence KFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMA Gene ID Swiss Prot Synonyms NIP1; SEC20; TRG-8 Calculated MW 26kDa Observed MW 26kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse heart, Rat heart Cellular location Cytoplasm, Endoplasmic reticulum, Mitochondrial membrane, Nuclear envelope, SNARE complex 
Western blot analysis of extracts of various cell lines, using BNIP1 Rabbit mAb (A4405) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat brain using BNIP1 Rabbit mAb (A4405) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using BNIP1 Rabbit mAb (A4405) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human BNIP1 (Q12981). Isotype IgG