быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
APOL1 Rabbit mAb (A4412)
- Описание
- Характеристики
-
Overview
Product name APOL1 Rabbit mAb Catalog No. A4412 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1124 Background
This gene encodes a secreted high density lipoprotein which binds to apolipoprotein A-I. Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Several different transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human APOL1 (O14791). Sequence RPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL Gene ID Swiss Prot Synonyms APOL; APO-L; FSGS4; APOL-I Calculated MW 44kDa Observed MW 55kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HepG2, LO2, Human plasma Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using APOL1 Rabbit mAb (A4412) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of HepG2 cells using APOL1 Rabbit mAb (A4412) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 303-398 of human APOL1 (O14791). Isotype IgG