быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SENP1 Rabbit mAb (A4460)
- Описание
- Характеристики
-
Overview
Product name SENP1 Rabbit mAb Catalog No. A4460 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1016 Background
This gene encodes a cysteine protease that specifically targets members of the small ubiquitin-like modifier (SUMO) protein family. This protease regulates SUMO pathways by deconjugating sumoylated proteins. This protease also functions to process the precursor SUMO proteins into their mature form. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-501 of human SENP1 (Q9P0U3). Sequence VTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKL Gene ID Swiss Prot Synonyms SuPr-2 Calculated MW 73kDa Observed MW 73kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, PC-3 Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using SENP1 Rabbit mAb (A4460) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-501 of human SENP1 (Q9P0U3). Isotype IgG