быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Casein Kinase 2 beta (CSNK2B) Rabbit mAb (A4519)
- Описание
- Характеристики
-
Overview
Product name Casein Kinase 2 beta (CSNK2B) Rabbit mAb Catalog No. A4519 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1069 Background
This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (CSNK2B) (P67870). Sequence YQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR Gene ID Swiss Prot Synonyms G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS Calculated MW 25kDa Observed MW 25kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, K-562, U-251MG, Mouse testis, Mouse spleen, Mouse kidney, Rat testis Cellular location cytoplasm, cytosol, extracellular exosome, extracellular region, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of paraffin-embedded rat brain using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using Casein Kinase 2 beta (CSNK2B) (CSNK2B) Rabbit mAb (A4519) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-215 of human Casein Kinase 2 beta (CSNK2B) (CSNK2B) (P67870). Isotype IgG