быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PRPF8 Rabbit mAb (A4575)
- Описание
- Характеристики
-
Overview
Product name PRPF8 Rabbit mAb Catalog No. A4575 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1038 Background
Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is a component of both U2- and U12-dependent spliceosomes, and found to be essential for the catalytic step II in pre-mRNA splicing process. It contains several WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp8 protein. This gene is a candidate gene for autosomal dominant retinitis pigmentosa.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2200-2335 of human PRPF8 (Q6P2Q9). Sequence MADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA Gene ID Swiss Prot Synonyms PRP8; RP13; HPRP8; PRPC8; SNRNP220 Calculated MW 274kDa Observed MW 274kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, 293T, Jurkat, Mouse brain, Mouse spleen Cellular location Nucleus speckle 
Western blot analysis of extracts of various cell lines, using PRPF8 Rabbit mAb (A4575) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded rat brain using PRPF8 Rabbit mAb (A4575) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using PRPF8 Rabbit mAb (A4575) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using PRPF8 Rabbit mAb (A4575) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of U-2 OS cells using PRPF8 Rabbit mAb (A4575) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2200-2335 of human PRPF8 (Q6P2Q9). Isotype IgG