быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PMS2 Rabbit mAb (A4577)
- Описание
- Характеристики
-
Overview
Product name PMS2 Rabbit mAb Catalog No. A4577 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1039 Background
The protein encoded by this gene is a key component of the mismatch repair system that functions to correct DNA mismatches and small insertions and deletions that can occur during DNA replication and homologous recombination. This protein forms heterodimers with the gene product of the mutL homolog 1 (MLH1) gene to form the MutL-alpha heterodimer. The MutL-alpha heterodimer possesses an endonucleolytic activity that is activated following recognition of mismatches and insertion/deletion loops by the MutS-alpha and MutS-beta heterodimers, and is necessary for removal of the mismatched DNA. There is a DQHA(X)2E(X)4E motif found at the C-terminus of the protein encoded by this gene that forms part of the active site of the nuclease. Mutations in this gene have been associated with hereditary nonpolyposis colorectal cancer (HNPCC; also known as Lynch syndrome) and Turcot syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PMS2 (P54278). Sequence MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQ Gene ID Swiss Prot Synonyms MLH4; PMS-2; PMSL2; HNPCC4; LYNCH4; MMRCS4; PMS2CL Calculated MW 96kDa Observed MW 110kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Jurkat cells, SH-SY5Y cells, HeLa cells Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using PMS2 antibody (A4577) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PMS2 (P54278). KO Validated Validated Isotype IgG







