быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
GluR4/GluA4/GRIA4 Rabbit mAb (A4593)
- Описание
- Характеристики
-
Overview
Product name GluR4/GluA4/GRIA4 Rabbit mAb Catalog No. A4593 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1045 Background
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing of this gene results in transcript variants encoding different isoforms, which may vary in their signal transduction properties. Some haplotypes of this gene show a positive association with schizophrenia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-902 of human GluR4/GluA4/GRIA4 (P48058). Sequence SGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP Gene ID Swiss Prot Synonyms GLUR4; GLURD; GluA4; GLUR4C; NEDSGA; GluA4-ATD Calculated MW 101kDa Observed MW 101kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain, Rat brain Cellular location Cell junction, Cell membrane, Cell projection, Multi-pass membrane protein, dendrite, postsynaptic cell membrane, synapse 
Western blot analysis of extracts of various cell lines, using GluR4/GluA4/GRIA4Rabbit mAb (A4593) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-902 of human GluR4/GluA4/GRIA4 (P48058). Isotype IgG







