быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
SQS/FDFT1 Rabbit mAb (A4651)
- Описание
- Характеристики
-
Overview
Product name SQS/FDFT1 Rabbit mAb Catalog No. A4651 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1077 Background
This gene encodes a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SQS/FDFT1 (P37268). Sequence MGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPE Gene ID Swiss Prot Synonyms SS; SQS; DGPT; ERG9; SQSD Calculated MW 48kDa Observed MW 48kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A-549, U-251MG, Mouse kidney, Rat liver Cellular location Endoplasmic reticulum membrane, Multi-pass membrane protein Customer validation (HeLa、MOLT-4、Jurkat、HepG2、 U2-OS、 PC-3)
Western blot analysis of extracts of various cell lines, using SQS/FDFT1 Rabbit mAb (A4651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of Mouse kidney, using SQS/FDFT1 Rabbit mAb (A4651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SQS/FDFT1 (P37268). Isotype IgG