быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
L-Plastin/LCP1 Rabbit mAb (A4664)
- Описание
- Характеристики
-
Overview
Product name L-Plastin/LCP1 Rabbit mAb Catalog No. A4664 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2689 Background
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 528-627 of human L-Plastin/LCP1 (P13796). Sequence TLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV Gene ID Swiss Prot Synonyms LPL; CP64; PLS2; LC64P; HEL-S-37; L-PLASTIN Calculated MW 70kDa Observed MW 70kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Raji Cellular location Actin cytoskeleton, Cytoplasm, Cytosol, Extracellular exosome, Extracellular space, Filopodium, Focal adhesion, Glial cell projection, Perinuclear region of cytoplasm, Phagocytic cup, Plasma membrane, podosome, Ruffle membrane 
Western blot analysis of extracts of Raji cells, using L-Plastin/LCP1 antibody (A4664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon using L-Plastin/LCP1 Rabbit mAb (A4664) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using L-Plastin/LCP1 Rabbit mAb (A4664) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 528-627 of human L-Plastin/LCP1 (P13796). Isotype IgG