быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
K-Cadherin (CDH6) Rabbit mAb (A4689)
- Описание
- Характеристики
-
Overview
Product name K-Cadherin (CDH6) Rabbit mAb Catalog No. A4689 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1093 Background
This gene encodes a member of the cadherin superfamily. Cadherins are membrane glycoproteins that mediate homophilic cell-cell adhesion and play critical roles in cell differentiation and morphogenesis. The encoded protein is a type II cadherin and may play a role in kidney development as well as endometrium and placenta formation. Decreased expression of this gene may be associated with tumor growth and metastasis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 691-790 of human K-Cadherin (CDH6) (P55285). Sequence DIVPEALFLPRRTPTARDNTDVRDFINQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADMYGGVDSDKDS Gene ID Swiss Prot Synonyms CAD6; KCAD Calculated MW 88kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, Hep G2, Mouse brain, Rat brain Cellular location Cell membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using K-Cadherin (CDH6) Rabbit mAb (A4689) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using K-Cadherin (CDH6) Rabbit mAb (A4689) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 691-790 of human K-Cadherin (CDH6) (P55285). Isotype IgG