быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LOXL2 Rabbit mAb (A4708)
- Описание
- Характеристики
-
Overview
Product name LOXL2 Rabbit mAb Catalog No. A4708 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1100 Background
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 675-774 of human LOXL2 (Q9Y4K0). Sequence NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ Gene ID Swiss Prot Synonyms LOR; LOR2; WS9-14 Calculated MW 87kDa Observed MW 100kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, PC-3 Cellular location Chromosome, Nucleus, Secreted, basement membrane, extracellular matrix, extracellular space Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using LOXL2 Rabbit mAb (A4708) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 675-774 of human LOXL2 (Q9Y4K0). Isotype IgG