быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NUDC Rabbit mAb (A4719)
- Описание
- Характеристики
-
Overview
Product name NUDC Rabbit mAb Catalog No. A4719 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1103 Background
This gene encodes a nuclear distribution protein that plays an essential role in mitosis and cytokinesis. The encoded protein is involved in spindle formation during mitosis and in microtubule organization during cytokinesis. Pseudogenes of this gene are found on chromosome 2.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 232-331 of human NUDC (Q9Y266). Sequence SWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN Gene ID Swiss Prot Synonyms HNUDC; MNUDC; NPD011 Calculated MW 38kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, HepG2, A-549, Mouse lung, Mouse brain, Rat brain Cellular location Cytoplasm, Nucleus, cytoskeleton 
Western blot analysis of various lysates, using NUDC Rabbit mAb (A4719) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 232-331 of human NUDC (Q9Y266). Isotype IgG