быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Dystrophin Rabbit mAb (A4746)
- Описание
- Характеристики
-
Overview
Product name Dystrophin Rabbit mAb Catalog No. A4746 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1118 Background
This gene spans a genomic range of greater than 2 Mb and encodes a large protein containing an N-terminal actin-binding domain and multiple spectrin repeats. The encoded protein forms a component of the dystrophin-glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. Deletions, duplications, and point mutations at this gene locus may cause Duchenne muscular dystrophy (DMD), Becker muscular dystrophy (BMD), or cardiomyopathy. Alternative promoter usage and alternative splicing result in numerous distinct transcript variants and protein isoforms for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 3586-3685 of human Dystrophin (P11532). Sequence LESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQRSDSSQPMLLRVVGSQTSDSMGEEDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNTPGKPMREDTM Gene ID Swiss Prot Synonyms BMD; CMD3B; MRX85; DXS142; DXS164; DXS206; DXS230; DXS239; DXS268; DXS269; DXS270; DXS272 Calculated MW 427kDa Observed MW Refer to figures Applications
Reactivity Mouse, Rat Tested applications IHC-P IF/ICC Recommended dilution - IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunofluorescence Positive samples Cellular location cell projection, cortical actin cytoskeleton, cytoskeleton, cytosol, filopodium membrane, neuron projection terminus, nucleus, plasma membrane, postsynaptic membrane, synapse, Z disc 
Immunohistochemistry analysis of paraffin-embedded rat skeletal muscle using Dystrophin Rabbit mAb (A4746) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse heart using Dystrophin Rabbit mAb (A4746) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of rat bone marrow using Dystrophin Rabbit mAb (A4746) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse bone marrow using Dystrophin Rabbit mAb (A4746) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 3586-3685 of human Dystrophin (P11532). Isotype IgG