быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MUC2 Rabbit mAb (A4767)
- Описание
- Характеристики
-
Overview
Product name MUC2 Rabbit mAb Catalog No. A4767 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1012 Background
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 5000-5100 of human MUC2 (Q02817). Sequence PDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG Gene ID Swiss Prot Synonyms MLP; SMUC; MUC-2 Calculated MW 551kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, SGC-7901, Mouse stomach, Rat large intestine Cellular location Secreted Customer validation WB(Mus musculus, mmu)
Western blot analysis of extracts of various cell lines, using MUC2 Rabbit mAb (A4767) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of Rat large intestine, using MUC2 Rabbit mAb (A4767) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry of paraffin-embedded human colon carcinoma using MUC2 Rabbit mAb (A4767) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon using MUC2 Rabbit mAb (A4767) at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 5000-5100 of human MUC2 (Q02817). Isotype IgG