быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BDNF Rabbit mAb (A4873)
- Описание
- Характеристики
-
Overview
Product name BDNF Rabbit mAb Catalog No. A4873 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0303 Background
This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human BDNF (P23560). Sequence VPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGID Gene ID Swiss Prot Synonyms ANON2; BULN2 Calculated MW 28kDa Observed MW 15kDa/28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples THP-1 Cellular location Secreted Customer validation WB(Rattus norvegicus, Mus musculus)
IHC(Homo sapiens)
Western blot analysis of extracts of THP-1 cells, using BDNF Rabbit mAb (A4873) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of mouse brain using BDNF Rabbit mAb (A4873) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human BDNF (P23560). Isotype IgG