быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Cardiac troponin T (TNNT2) Rabbit mAb (A4914)
- Описание
- Характеристики
-
Overview
Product name Cardiac troponin T (TNNT2) Rabbit mAb Catalog No. A4914 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1242 Background
This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 199-298 of human Cardiac troponin T (TNNT2) (P45379). Sequence QKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK Gene ID Swiss Prot Synonyms CMH2; RCM3; TnTC; cTnT; CMD1D; CMPD2; LVNC6 Calculated MW 36kDa Observed MW 36kDa Applications
Reactivity Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:2000 - 1:5000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse skeletal muscle Cellular location cardiac myofibril, cytosol, sarcomere, striated muscle thin filament Customer validation (heart frozen sections)
WB(Mus musculus, Homo sapiens)
IF(Mus musculus, Homo sapiens)
FC(Mus musculus)
Western blot analysis of extracts of Mouse skeletal muscle, using Cardiac troponin T (TNNT2) Rabbit mAb (A4914) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded mouse heart using Cardiac troponin T (TNNT2) Rabbit mAb (A4914) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of mouse heart using Cardiac troponin T (TNNT2) Rabbit mAb (A4914) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat heart using Cardiac troponin T (TNNT2) Rabbit mAb (A4914) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 199-298 of human Cardiac troponin T (TNNT2) (P45379). Isotype IgG