быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Arginase 1 (ARG1) Rabbit mAb (A4923)
- Описание
- Характеристики
-
Overview
Product name Arginase 1 (ARG1) Rabbit mAb Catalog No. A4923 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1164 Background
Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Arginase 1 (ARG1) (P05089). Sequence MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD Gene ID Swiss Prot Synonyms ARG1; arginase-1 Calculated MW 35kDa Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:2000 - 1:6000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Rat liver Cellular location Cytoplasm, nuclear Customer validation WB(Mus musculus, Homo sapiens, Rattus norvegicus)
IHC(Sus scrofa, Mus musculus)
WB (Mus musculus)
IF(Mus musculus)
Western blot analysis of extracts of Rat liver, using Arginase 1 (Arginase 1 (ARG1)) Rabbit mAb (A4923) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of rat liver using Arginase 1 (ARG1) Rabbit mAb (A4923) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human liver using Arginase 1 (ARG1) Rabbit mAb (A4923) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse liver using Arginase 1 (ARG1) Rabbit mAb (A4923) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Arginase 1 (ARG1) (P05089). Isotype IgG