быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LMAN1 Rabbit mAb (A4941)
- Описание
- Характеристики
-
Overview
Product name LMAN1 Rabbit mAb Catalog No. A4941 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1978 Background
The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMAN1 (P49257). Sequence MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAA Gene ID Swiss Prot Synonyms MR60; gp58; F5F8D; FMFD1; MCFD1; ERGIC53; ERGIC-53 Calculated MW 54kDa Observed MW 58kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, 293T, NCI-H460, Mouse liver, Mouse brain, Mouse heart, Rat lung, Rat liver, Rat kidney Cellular location Endoplasmic reticulum membrane, Endoplasmic reticulum-Golgi intermediate compartment membrane, Golgi apparatus membrane, Single-pass membrane protein, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using LMAN1 Rabbit mAb (A4941) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat brain using LMAN1 Rabbit mAb (A4941) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human appendix using LMAN1 Rabbit mAb (A4941) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using LMAN1 Rabbit mAb (A4941) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMAN1 (P49257). Isotype IgG