быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EGFR (L858R) Rabbit mAb (A5031)
- Описание
- Характеристики
-
Overview
Product name EGFR (L858R) Rabbit mAb Catalog No. A5031 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1139 Background
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human EGFR (L858R) (P00533). Sequence DYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY Gene ID Swiss Prot Synonyms ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2 Calculated MW 134kDa Observed MW 175kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse brain Cellular location Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein 
Western blot analysis of extracts of Mouse brain cells, using EGFR (L858R) Rabbit mAb (A5031) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma (egfr-e745-a750del positive sample) using EGFR (L858R) Rabbit mAb (A5031) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma (egfr-l858r positive sample) using EGFR (L858R) Rabbit mAb (A5031) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma (egfr-l858r positive sample) using EGFR (L858R) Rabbit mAb (A5031) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma (egfr-l858r positive sample) using EGFR (L858R) Rabbit mAb (A5031) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 800-900 of human EGFR (L858R) (P00533). KO Validated Validated Isotype IgG