быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HLTF Rabbit mAb (A5068)
- Описание
- Характеристики
-
Overview
Product name HLTF Rabbit mAb Catalog No. A5068 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1982 Background
This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527). Sequence TEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL Gene ID Swiss Prot Synonyms ZBU1; HLTF1; RNF80; HIP116; SNF2L3; HIP116A; SMARCA3 Calculated MW 114kDa Observed MW 114kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, HepG2, Mouse lung, Mouse heart, Rat lung Cellular location Cytoplasm, Nucleus, nucleolus, nucleoplasm Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using HLTF Rabbit mAb (A5068) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 900-1009 of human HLTF (Q14527). Isotype IgG