быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
p60 CAF1 Rabbit mAb (A5073)
- Описание
- Характеристики
-
Overview
Product name p60 CAF1 Rabbit mAb Catalog No. A5073 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1269 Background
Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 459-559 of human p60 CAF1 (Q13112). Sequence PLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP Gene ID Swiss Prot Synonyms CAF1; MPP7; CAF-1; CAF1A; CAF1P60; CAF-IP60; MPHOSPH7 Calculated MW 61kDa Observed MW 70kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, 293T, Jurkat Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts of various cell lines, using p60 CAF1 Rabbit mAb (A5073) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using p60 CAF1 Rabbit mAb (A5073) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 459-559 of human p60 CAF1 (Q13112). Isotype IgG