быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PRMT6 Rabbit mAb (A5085)
- Описание
- Характеристики
-
Overview
Product name PRMT6 Rabbit mAb Catalog No. A5085 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1277 Background
The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PRMT6 (Q96LA8). Sequence MLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE Gene ID Swiss Prot Synonyms HRMT1L6 Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, MCF7, NIH/3T3, Jurkat, Rat testis Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using PRMT6 Rabbit mAb (A5085) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PRMT6 (Q96LA8). Isotype IgG







