быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TEAD1/2/3/4 mAb (A5092)
- Описание
- Характеристики
-
Overview
Product name TEAD1/2/3/4 mAb Catalog No. A5092 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1158 Background
This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 174-263 of human TEAD4 (NP_003204.2) Sequence SHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLE Gene ID Swiss Prot Synonyms AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1 Calculated MW 48, 48, 49, 47kDa Observed MW 50, 53, 55, 60kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, BxPC-3 Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using TEAD1 Rabbit mAb (A5092) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 174-263 of human TEAD4 (NP_003204.2) Isotype IgG