быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
EBP1/PA2G4 Rabbit mAb (A5114)
- Описание
- Характеристики
-
Overview
Product name EBP1/PA2G4 Rabbit mAb Catalog No. A5114 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1281 Background
This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human EBP1/PA2G4 (NP_006182.2). Sequence ELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD Gene ID Swiss Prot Synonyms EBP1; HG4-1; ITAF45; p38-2G4 Calculated MW 44kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, 293T, Jurkat, Mouse lung, Mouse brain, Rat brain Cellular location Cytoplasm, Nucleus, nucleolus 
Western blot analysis of extracts of various cell lines, using EBP1/PA2G4 Rabbit mAb (A5114) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of extracts of Rat brain, using EBP1/PA2G4 Rabbit mAb (A5114) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded rat testis using EBP1/PA2G4 Rabbit mAb (A5114) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using EBP1/PA2G4 Rabbit mAb (A5114) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using EBP1/PA2G4 Rabbit mAb (A5114) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using EBP1/PA2G4 Rabbit mAb (A5114) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human EBP1/PA2G4 (NP_006182.2). Isotype IgG