быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LDHB Rabbit mAb (A5131)
- Описание
- Характеристики
-
Overview
Product name LDHB Rabbit mAb Catalog No. A5131 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1217 Background
This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LDHB (P07195). Sequence MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVR Gene ID Swiss Prot Synonyms LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281 Calculated MW 37kDa Observed MW 36kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa, Jurkat Cellular location Cytoplasm, Mitochondrion inner membrane 
Western blot analysis of extracts of various cell lines, using LDHB Rabbit mAb (A5131) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded rat ovary using LDHB Rabbit mAb (A5131) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human appendix using LDHB Rabbit mAb (A5131) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg LDHB antibody (A5131). Western blot was performed from the immunoprecipitate using LDHB antibody (A5131) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LDHB (P07195). Isotype IgG