быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BHMT Rabbit mAb (A5134)
- Описание
- Характеристики
-
Overview
Product name BHMT Rabbit mAb Catalog No. A5134 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1249 Background
This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-406 of human BHMT (Q93088). Sequence CGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ Gene ID Swiss Prot Synonyms BHMT1; HEL-S-61p Calculated MW 45kDa Observed MW 48kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HepG2, Mouse liver, Mouse kidney, Rat liver Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using BHMT Rabbit mAb (A5134) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180S. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-406 of human BHMT (Q93088). Isotype IgG