быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Contactin 2 Rabbit mAb (A5137)
- Описание
- Характеристики
-
Overview
Product name Contactin 2 Rabbit mAb Catalog No. A5137 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1984 Background
This gene encodes a member of the contactin family of proteins, part of the immunoglobulin superfamily of cell adhesion molecules. The encoded glycosylphosphatidylinositol (GPI)-anchored neuronal membrane protein plays a role in the proliferation, migration, and axon guidance of neurons of the developing cerebellum. A mutation in this gene may be associated with adult myoclonic epilepsy.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Contactin 2 (Q02246). Sequence MGTATRRKPHLLLVAAVALVSSSAWSSALGSQTTFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNP Gene ID Swiss Prot Synonyms AXT; TAX; TAX1; FAME5; TAG-1 Calculated MW 113kDa Observed MW 150kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, C6, SH-SY5Y, U-251MG, Mouse lung, Mouse spinal cord, Mouse brain, Rat brain Cellular location Cell membrane, GPI-anchor, Lipid-anchor 
Western blot analysis of extracts of various cell lines, using Contactin 2 Rabbit mAb (A5137) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Contactin 2 (Q02246). Isotype IgG