быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CD155/PVR Rabbit mAb (A5138)
- Описание
- Характеристики
-
Overview
Product name CD155/PVR Rabbit mAb Catalog No. A5138 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1178 Background
The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD155/PVR (P15151). Sequence GYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVL Gene ID Swiss Prot Synonyms PVS; HVED; CD155; NECL5; TAGE4; Necl-5 Calculated MW 45kDa Observed MW 70kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, HT-1080, HUVEC Cellular location Cell membrane, Secreted, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using CD155/PVR Rabbit mAb (A5138) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD155/PVR (P15151). Isotype IgG