быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
BGAT Rabbit mAb (A5207)
- Описание
- Характеристики
-
Overview
Product name BGAT Rabbit mAb Catalog No. A5207 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1251 Background
This gene encodes proteins related to the first discovered blood group system, ABO. Variation in the ABO gene (chromosome 9q34.2) is the basis of the ABO blood group, thus the presence of an allele determines the blood group in an individual. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BGAT (P16442). Sequence MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTF Gene ID Swiss Prot Synonyms GTB; NAGAT; A3GALNT; A3GALT1 Calculated MW 41kDa Observed MW 41kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, THP-1 Cellular location Golgi apparatus, Golgi stack membrane, Secreted, Single-pass type II membrane protein 
Western blot analysis of extracts of various cell lines, using BGAT Rabbit mAb (A5207) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BGAT (P16442). Isotype IgG