быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
KIFAP3 Rabbit mAb (A5216)
- Описание
- Характеристики
-
Overview
Product name KIFAP3 Rabbit mAb Catalog No. A5216 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1211 Background
The small G protein GDP dissociation stimulator (smg GDS) is a regulator protein having two activities on a group of small G proteins including the Rho and Rap1 family members and Ki-Ras; one is to stimulate their GDP/GTP exchange reactions, and the other is to inhibit their interactions with membranes. The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein. Several transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 675-792 of human KIFAP3 (Q92845). Sequence KFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS Gene ID Swiss Prot Synonyms FLA3; KAP3; SMAP; KAP-1; KAP-3; Smg-GDS; dJ190I16.1 Calculated MW 91kDa Observed MW 100kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Mouse brain, Rat brain Cellular location axoneme, centrosome, ciliary basal body, condensed nuclear chromosome, cytosol, endoplasmic reticulum, Golgi apparatus, microtubule cytoskeleton, photoreceptor inner segment, photoreceptor outer segment 
Western blot analysis of extracts of various cell lines, using KIFAP3 Rabbit mAb (A5216) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of NIH-3T3 cells using KIFAP3 Rabbit mAb (A5216) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using KIFAP3 Rabbit mAb (A5216) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 675-792 of human KIFAP3 (Q92845). Isotype IgG