быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
HSPE1/HSP10/CPN10 Rabbit mAb (A5580)
- Описание
- Характеристики
-
Overview
Product name HSPE1/HSP10/CPN10 Rabbit mAb Catalog No. A5580 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1411 Background
This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human HSPE1/HSP10/CPN10 (P61604). Sequence GSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD Gene ID Swiss Prot Synonyms EPF; CPN10; GROES; HSP10 Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples MCF7, C6, U-251MG, Neuro-2a, Rat kidney Cellular location Mitochondrion matrix 
Western blot analysis of extracts of various cell lines, using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat brain using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human HSPE1/HSP10/CPN10 (P61604). Isotype IgG