быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DLX5 Rabbit mAb (A5586)
- Описание
- Характеристики
-
Overview
Product name DLX5 Rabbit mAb Catalog No. A5586 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1994 Background
This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human DLX5 (P56178). Sequence AALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPAS Gene ID Swiss Prot Synonyms SHFM1; SHFM1D Calculated MW 32kDa Observed MW 32kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, U-87MG Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using DLX5 Rabbit mAb (A5586) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human DLX5 (P56178). Isotype IgG