быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NME2/NM23B Rabbit mAb (A5621)
- Описание
- Характеристики
-
Overview
Product name NME2/NM23B Rabbit mAb Catalog No. A5621 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1412 Background
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-152 of human NME2/NM23B (P22392). Sequence QHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Gene ID Swiss Prot Synonyms PUF; NDKB; NDPKB; NM23B; NDPK-B; NM23-H2 Calculated MW 17kDa Observed MW 17kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse brain, Mouse kidney, Mouse heart, Rat brain, Rat kidney, Rat heart Cellular location Cell projection, Cytoplasm, Nucleus, Lamellipodium, Ruffle 
Western blot analysis of extracts of various lysates, using NME2/NM23B Rabbit mAb (A5621) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-152 of human NME2/NM23B (P22392). Isotype IgG