быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PIK3R4/VPS15 Rabbit mAb (A5922)
- Описание
- Характеристики
-
Overview
Product name PIK3R4/VPS15 Rabbit mAb Catalog No. A5922 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2090 Background
Predicted to enable protein serine/threonine kinase activity. Involved in positive regulation of phosphatidylinositol 3-kinase activity; receptor catabolic process; and regulation of cytokinesis. Located in late endosome and microtubule cytoskeleton.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1259-1358 of human PIK3R4/VPS15 (Q99570). Sequence AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK Gene ID Swiss Prot Synonyms p150; VPS15 Calculated MW 153kDa Observed MW 153kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Raji, Mouse lung, Mouse brain, Rat brain Cellular location Autophagosome, axoneme, cytosol, late endosome, microtubule cytoskeleton 
Western blot analysis of extracts of various cell lines, using PIK3R4/VPS15 Rabbit mAb (A5922) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts of Rat brain, using PIK3R4/VPS15 Rabbit mAb (A5922) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of HeLa cells using PIK3R4/VPS15 Rabbit mAb (A5922) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using PIK3R4/VPS15 Rabbit mAb (A5922) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1259-1358 of human PIK3R4/VPS15 (Q99570). Isotype IgG