быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CEND1 Rabbit mAb (A5930)
- Описание
- Характеристики
-
Overview
Product name CEND1 Rabbit mAb Catalog No. A5930 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2092 Background
The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-149 of human CEND1 (NP_057648.2). Sequence ALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPLLVAGGVAVAAIALILGVAFLVRKK Gene ID Swiss Prot Synonyms BM88 Calculated MW 15kDa Observed MW 22kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples SH-SY5Y, U-87MG, Mouse brain, Rat brain Cellular location 
Western blot analysis of extracts of various cell lines, using CEND1 Rabbit mAb (A5930) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of rat brain cells using CEND1 Rabbit mAb (A5930) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse brain cells using CEND1 Rabbit mAb (A5930) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-149 of human CEND1 (NP_057648.2). Isotype IgG