быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PCYT1A Rabbit mAb (A5935)
- Описание
- Характеристики
-
Overview
Product name PCYT1A Rabbit mAb Catalog No. A5935 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2098 Background
This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. Alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 268-367 of human PCYT1A (P49585). Sequence EEKSIDLIQKWEEKSREFIGSFLEMFGPEGALKHMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYDISEDEED Gene ID Swiss Prot Synonyms CT; CTA; CCTA; CTPCT; PCYT1; SMDCRD; CCTalpha Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-1080 Cellular location Cytosol, Endoplasmic reticulum, Glycogen granule, Nuclear envelope, Nucleus, plasma membrane 
Western blot analysis of extracts of K-562 cells, using PCYT1A Rabbit mAb (A5935) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 268-367 of human PCYT1A (P49585). Isotype IgG