быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
PARP2 Rabbit mAb (A5945)
- Описание
- Характеристики
-
Overview
Product name PARP2 Rabbit mAb Catalog No. A5945 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2099 Background
This gene encodes poly(ADP-ribosyl)transferase-like 2 protein, which contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of the protein. Two alternatively spliced transcript variants encoding distinct isoforms have been found.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 484-583 of human PARP2 (Q9UGN5). Sequence LLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW Gene ID Swiss Prot Synonyms ARTD2; ADPRT2; PARP-2; ADPRTL2; ADPRTL3; pADPRT-2 Calculated MW 66kDa Observed MW 60kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A-549, SH-SY5Y Cellular location Chromosome, Nucleus 
Western blot analysis of extracts of various cell lines, using PARP2 Rabbit mAb (A5945) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 484-583 of human PARP2 (Q9UGN5). Isotype IgG







