быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
FGF7/KGF Rabbit mAb (A5966)
- Описание
- Характеристики
-
Overview
Product name FGF7/KGF Rabbit mAb Catalog No. A5966 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2107 Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF7/FGF7/KGF (NP_002000.1). Sequence MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEI Gene ID Swiss Prot Synonyms KGF; HBGF-7; Fibroblast growth factor 7 Calculated MW 12kDa/23kDa Observed MW 28kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, A549, Raji, Mouse lung, Mouse spleen, Mouse uterus, Rat lung, Rat spleen, Rat uterus Cellular location Cytoplasm, Extracellular region, Extracellular space, Golgi apparatus 
Western blot analysis of extracts of various cell lines, using FGF7/FGF7/KGF Rabbit mAb (A5966) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF7/FGF7/KGF (NP_002000.1). Isotype IgG