быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
CEACAM6 Rabbit mAb (A5971)
- Описание
- Характеристики
-
Overview
Product name CEACAM6 Rabbit mAb Catalog No. A5971 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2110 Background
This gene encodes a protein that belongs to the carcinoembryonic antigen (CEA) family whose members are glycosyl phosphatidyl inositol (GPI) anchored cell surface glycoproteins. Members of this family play a role in cell adhesion and are widely used as tumor markers in serum immunoassay determinations of carcinoma. This gene affects the sensitivity of tumor cells to adenovirus infection. The protein encoded by this gene acts as a receptor for adherent-invasive E. coli adhesion to the surface of ileal epithelial cells in patients with Crohn's disease. This gene is clustered with genes and pseudogenes of the cell adhesion molecules subgroup of the CEA family on chromosome 19.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CEACAM6 (P40199). Sequence LTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQ Gene ID Swiss Prot Synonyms NCA; CEAL; CD66c Calculated MW 37kDa Observed MW 37kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples A-549, Mouse liver Cellular location apical plasma membrane, cell surface, extracellular space, plasma membrane 
Western blot analysis of extracts of various cell lines, using CEACAM6 Rabbit mAb (A5971) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of rat rectum cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of human colon carcinoma cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse large intestine cells using CEACAM6 Rabbit mAb (A5971) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CEACAM6 (P40199). Isotype IgG