быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Syntaxin 4 Rabbit mAb (A5996)
- Описание
- Характеристики
-
Overview
Product name Syntaxin 4 Rabbit mAb Catalog No. A5996 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2113 Background
Enables sphingomyelin phosphodiesterase activator activity. Involved in several processes, including cornified envelope assembly; positive regulation of immune effector process; and positive regulation of protein localization. Located in several cellular components, including basolateral plasma membrane; cytoplasmic vesicle; and lamellipodium. Part of SNARE complex. Is active in glutamatergic synapse and postsynapse.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (NP_004595.2)). Sequence QTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE Gene ID Swiss Prot Synonyms STX4A; p35-2 Calculated MW 34kDa Observed MW 34kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples A549, Mouse lung, Rat brain Cellular location basolateral plasma membrane, cytosol, dendritic spine, endosome, extracellular exosome, extracellular space, glutamatergic synapse, lateral loop, myelin sheath adaxonal region, neuron projection membrane, perinuclear region of cytoplasm, plasma membrane, postsynapse, presynaptic active zone membrane, SNARE complex, synapse, synaptic vesicle, trans-Golgi network 
Western blot analysis of extracts of various cell lines, using Syntaxin 4 Rabbit mAb (A5996) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of Rat brain, using Syntaxin 4 Rabbit mAb (A5996) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH-3T3 cells using Syntaxin 4 Rabbit mAb (A5996) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (NP_004595.2)). Isotype IgG