быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
LMO4 Rabbit mAb (A5999)
- Описание
- Характеристики
-
Overview
Product name LMO4 Rabbit mAb Catalog No. A5999 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2114 Background
This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 66-165 of human LMO4 (P61968). Sequence TKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC Gene ID Swiss Prot Synonyms Calculated MW 18kDa Observed MW 18kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, MCF7, PC-3, Mouse kidney, Rat lung, Rat brain, Rat kidney Cellular location nucleus 
Western blot analysis of extracts of various cell lines, using LMO4 Rabbit mAb (A5999) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 66-165 of human LMO4 (P61968). Isotype IgG