быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
NAP1L1 Rabbit mAb (A6174)
- Описание
- Характеристики
-
Overview
Product name NAP1L1 Rabbit mAb Catalog No. A6174 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1888 Background
This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NAP1L1 (P55209). Sequence MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVH Gene ID Swiss Prot Synonyms NRP; NAP1; NAP1L Calculated MW 45kDa Observed MW 52kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, 293T, A-431, NIH/3T3, Mouse testis, Rat lung, Rat spleen Cellular location Melanosome, Nucleus, Cytoplasm 
Western blot analysis of extracts of various cell lines, using NAP1L1 Rabbit mAb (A6174) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using NAP1L1 Rabbit mAb (A6174) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Immunofluorescence analysis of C6 cells using NAP1L1 Rabbit mAb (A6174) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH-3T3 cells using NAP1L1 Rabbit mAb (A6174) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using NAP1L1 Rabbit mAb (A6174) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NAP1L1 (P55209). Isotype IgG